Lineage for d2gtha1 (2gth A:1-194)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 704539Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 704540Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families) (S)
  5. 705234Family c.66.1.48: Nsp15 N-terminal domain-like [142625] (1 protein)
    rudiment methyltransferase fold that probably has lost the enzymatic activity; contains extra N-terminal alpha+beta subdomain
  6. 705235Protein Nsp15 [142626] (2 species)
  7. 705236Species Murine hepatitis virus, MHV [TaxId:11138] [142627] (2 PDB entries)
  8. 705238Domain d2gtha1: 2gth A:1-194 [135650]
    Other proteins in same PDB: d2gtha2

Details for d2gtha1

PDB Entry: 2gth (more details), 2.7 Å

PDB Description: crystal structure of the wildtype MHV coronavirus non-structural protein nsp15
PDB Compounds: (A:) Replicase polyprotein 1ab

SCOP Domain Sequences for d2gtha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtha1 c.66.1.48 (A:1-194) Nsp15 {Murine hepatitis virus, MHV [TaxId: 11138]}
slenvvynlvnaghfdgragelpcavigekviakiqnedvvvfknntpfptnvavelfak
rsirphpelklfrnlnidvcwshvlwdyakdsvfcsstykvckytdlqcieslnvlfdgr
dngaleafkkcrngvyinttkikslsmikgpqradlngvvvekvgdsdvefwfavrkdgd
dvifsrtgslepsh

SCOP Domain Coordinates for d2gtha1:

Click to download the PDB-style file with coordinates for d2gtha1.
(The format of our PDB-style files is described here.)

Timeline for d2gtha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gtha2