![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.64: Saposin-like [47861] (2 superfamilies) 5 helices; folded leaf, closed |
![]() | Superfamily a.64.1: Saposin [47862] (5 families) ![]() Lipid-binding can promote conformational changes and oligomerisation in some members |
![]() | Family a.64.1.1: NKL-like [47863] (4 proteins) |
![]() | Protein Saposin C [89077] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89078] (11 PDB entries) |
![]() | Domain d2gtga_: 2gtg A: [135649] automated match to d1m12a_ |
PDB Entry: 2gtg (more details), 2.4 Å
SCOPe Domain Sequences for d2gtga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gtga_ a.64.1.1 (A:) Saposin C {Human (Homo sapiens) [TaxId: 9606]} dvycevceflvkevtklidnnktekeildafdkmcsklpkslseecqevvdtygssilsi lleevspelvcsmlhlcs
Timeline for d2gtga_: