SCOPe 2.07: Domain d2gtfx2: 2gtf X:1-179

Lineage for d2gtfx2 (2gtf X:1-179)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Nitrophorin 2 (prolixin-s) [50843] (1 species)

7. Species Rhodnius prolixus [TaxId:13249] [50844] (14 PDB entries)
   Uniprot Q26241

8. Domain d2gtfx2: 2gtf X:1-179 [135648]
   Other proteins in same PDB: d2gtfx3
   automated match to d1euoa_
   complexed with hem, p1r

Details for d2gtfx2

PDB Entry: 2gtf, 1.4 Å

PDB Description: crystal structure of nitrophorin 2 complex with pyrimidine

PDB Compounds: (X:) Nitrophorin-2

SCOPe Domain Sequences for d2gtfx2:

Sequence; same for both SEQRES and ATOM records:

>d2gtfx2 b.60.1.1 (X:1-179) Nitrophorin 2 (prolixin-s) {Rhodnius prolixus [TaxId: 13249]}
dcstnispkqgldkakyfsgkwyvthfldkdpqvtdqycssftpresdgtvkealyhyna
nkktsfynigegklessglqytakyktvdkkkavlkeadeknsytltvleaddssalvhi
clregskdlgdlytvlthqkdaepsakvksavtqaglqlsqfvgtkdlgcqyddqftsl

Timeline for d2gtfx2:

• d2gtfx2 first appeared in SCOP 1.73, called d2gtfx1
  
• d2gtfx2 appears in SCOPe 2.06
  
• d2gtfx2 appears in the current release, SCOPe 2.08