Lineage for d2gtfx2 (2gtf X:1-179)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2395396Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2395397Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2395398Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2395702Protein Nitrophorin 2 (prolixin-s) [50843] (1 species)
  7. 2395703Species Rhodnius prolixus [TaxId:13249] [50844] (14 PDB entries)
    Uniprot Q26241
  8. 2395708Domain d2gtfx2: 2gtf X:1-179 [135648]
    Other proteins in same PDB: d2gtfx3
    automated match to d1euoa_
    complexed with hem, p1r

Details for d2gtfx2

PDB Entry: 2gtf (more details), 1.4 Å

PDB Description: crystal structure of nitrophorin 2 complex with pyrimidine
PDB Compounds: (X:) Nitrophorin-2

SCOPe Domain Sequences for d2gtfx2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtfx2 b.60.1.1 (X:1-179) Nitrophorin 2 (prolixin-s) {Rhodnius prolixus [TaxId: 13249]}
dcstnispkqgldkakyfsgkwyvthfldkdpqvtdqycssftpresdgtvkealyhyna
nkktsfynigegklessglqytakyktvdkkkavlkeadeknsytltvleaddssalvhi
clregskdlgdlytvlthqkdaepsakvksavtqaglqlsqfvgtkdlgcqyddqftsl

SCOPe Domain Coordinates for d2gtfx2:

Click to download the PDB-style file with coordinates for d2gtfx2.
(The format of our PDB-style files is described here.)

Timeline for d2gtfx2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gtfx3