Lineage for d2gteb_ (2gte B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1268646Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1269819Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 1269820Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
    automatically mapped to Pfam PF01395
  6. 1269833Protein Odorant binding protein LUSH [101190] (1 species)
  7. 1269834Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101191] (12 PDB entries)
  8. 1269838Domain d2gteb_: 2gte B: [135647]
    automated match to d1oofa_
    complexed with po4, va

Details for d2gteb_

PDB Entry: 2gte (more details), 1.4 Å

PDB Description: Drosophila OBP LUSH bound to attractant pheromone 11-cis-vaccenyl acetate
PDB Compounds: (B:) General odorant-binding protein lush

SCOPe Domain Sequences for d2gteb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gteb_ a.39.2.1 (B:) Odorant binding protein LUSH {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtvnk
kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
fmwp

SCOPe Domain Coordinates for d2gteb_:

Click to download the PDB-style file with coordinates for d2gteb_.
(The format of our PDB-style files is described here.)

Timeline for d2gteb_: