Lineage for d2gteb1 (2gte B:1-124)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768455Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 769304Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (1 family) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 769305Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (5 proteins)
  6. 769320Protein Odorant binding protein LUSH [101190] (1 species)
  7. 769321Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101191] (6 PDB entries)
  8. 769327Domain d2gteb1: 2gte B:1-124 [135647]
    automatically matched to d1ooha_
    complexed with po4, va

Details for d2gteb1

PDB Entry: 2gte (more details), 1.4 Å

PDB Description: Drosophila OBP LUSH bound to attractant pheromone 11-cis-vaccenyl acetate
PDB Compounds: (B:) General odorant-binding protein lush

SCOP Domain Sequences for d2gteb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gteb1 a.39.2.1 (B:1-124) Odorant binding protein LUSH {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtvnk
kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
fmwp

SCOP Domain Coordinates for d2gteb1:

Click to download the PDB-style file with coordinates for d2gteb1.
(The format of our PDB-style files is described here.)

Timeline for d2gteb1: