SCOPe 2.02: Domain d2gtea_: 2gte A:

Lineage for d2gtea_ (2gte A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)

6. Protein Odorant binding protein LUSH [101190] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101191] (12 PDB entries)

8. Domain d2gtea_: 2gte A: [135646]
   automated match to d1oofa_
   complexed with po4, va

Details for d2gtea_

PDB Entry: 2gte, 1.4 Å

PDB Description: Drosophila OBP LUSH bound to attractant pheromone 11-cis-vaccenyl acetate

PDB Compounds: (A:) General odorant-binding protein lush

SCOPe Domain Sequences for d2gtea_:

Sequence; same for both SEQRES and ATOM records:

>d2gtea_ a.39.2.1 (A:) Odorant binding protein LUSH {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtvnk
kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
fmwp

Timeline for d2gtea_:

• d2gtea_ first appeared in SCOP 1.73, called d2gtea1
  
• d2gtea_ appears in SCOPe 2.01
  
• d2gtea_ appears in SCOPe 2.03
  
• d2gtea_ appears in the current release, SCOPe 2.08