SCOP 1.75: Domain d2gtea1: 2gte A:1-124

Lineage for d2gtea1 (2gte A:1-124)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (1 family)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (5 proteins)

6. Protein Odorant binding protein LUSH [101190] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101191] (6 PDB entries)

8. Domain d2gtea1: 2gte A:1-124 [135646]
   automatically matched to d1ooha_
   complexed with po4, va

Details for d2gtea1

PDB Entry: 2gte, 1.4 Å

PDB Description: Drosophila OBP LUSH bound to attractant pheromone 11-cis-vaccenyl acetate

PDB Compounds: (A:) General odorant-binding protein lush

SCOP Domain Sequences for d2gtea1:

Sequence; same for both SEQRES and ATOM records:

>d2gtea1 a.39.2.1 (A:1-124) Odorant binding protein LUSH {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtvnk
kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
fmwp

Timeline for d2gtea1:

• d2gtea1 first appeared in SCOP 1.73
  
• d2gtea1 is called d2gtea_ in SCOPe 2.01
  
• d2gtea1 appears in the current release, SCOPe 2.08, called d2gtea_