Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.13: CoaX-like [142484] (1 protein) Pfam PF03309; Bordetella pertussis Bvg accessory factor family, Baf |
Protein Type III pantothenate kinase, CoaX [142485] (3 species) |
Species Thermotoga maritima [TaxId:2336] [142486] (4 PDB entries) Uniprot Q9WZY5 1-118! Uniprot Q9WZY5 119-245 |
Domain d2gtde1: 2gtd E:1-121 [135642] automated match to d2gtda1 |
PDB Entry: 2gtd (more details), 2 Å
SCOPe Domain Sequences for d2gtde1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gtde1 c.55.1.13 (E:1-121) Type III pantothenate kinase, CoaX {Thermotoga maritima [TaxId: 2336]} mdpmyllvdvgnthsvfsitedgktfrrwrlstgvfqtedelfshlhpllgdamreikgi gvasvvptqntvierfsqkyfhispiwvkakngcvkwnvknpsevgadrvanvvafvkey g
Timeline for d2gtde1: