Lineage for d2gtda1 (2gtd A:4-121)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701285Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families) (S)
    duplication contains two domains of this fold
  5. 701884Family c.55.1.13: CoaX-like [142484] (1 protein)
    Pfam PF03309; Bordetella pertussis Bvg accessory factor family, Baf
  6. 701885Protein Type III pantothenate kinase, CoaX [142485] (3 species)
  7. 701900Species Thermotoga maritima [TaxId:2336] [142486] (1 PDB entry)
  8. 701901Domain d2gtda1: 2gtd A:4-121 [135634]

Details for d2gtda1

PDB Entry: 2gtd (more details), 2 Å

PDB Description: crystal structure of a type iii pantothenate kinase: insight into the catalysis of an essential coenzyme a biosynthetic enzyme universally distributed in bacteria
PDB Compounds: (A:) Type III pantothenate kinase

SCOP Domain Sequences for d2gtda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtda1 c.55.1.13 (A:4-121) Type III pantothenate kinase, CoaX {Thermotoga maritima [TaxId: 2336]}
myllvdvgnthsvfsitedgktfrrwrlstgvfqtedelfshlhpllgdamreikgigva
svvptqntvierfsqkyfhispiwvkakngcvkwnvknpsevgadrvanvvafvkeyg

SCOP Domain Coordinates for d2gtda1:

Click to download the PDB-style file with coordinates for d2gtda1.
(The format of our PDB-style files is described here.)

Timeline for d2gtda1: