Lineage for d2gtad1 (2gta D:2-111)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651014Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
    multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer
  4. 651015Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (4 families) (S)
    basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat
  5. 651028Family a.204.1.2: MazG-like [116993] (3 proteins)
    Pfam PF03819
  6. 651032Protein Hypothetical protein YpjD [140790] (1 species)
  7. 651033Species Bacillus subtilis [TaxId:1423] [140791] (1 PDB entry)
  8. 651037Domain d2gtad1: 2gta D:2-111 [135633]
    complexed with na

Details for d2gtad1

PDB Entry: 2gta (more details), 2.9 Å

PDB Description: crystal structure of the putative pyrophosphatase ypjd from bacillus subtilis. northeast structural genomics consortium target sr428.
PDB Compounds: (D:) Hypothetical protein ypjD

SCOP Domain Sequences for d2gtad1:

Sequence, based on SEQRES records: (download)

>d2gtad1 a.204.1.2 (D:2-111) Hypothetical protein YpjD {Bacillus subtilis [TaxId: 1423]}
sdktmkdiqaevdryigqfkegyfsplammarlteelgelarevnhrygekpkkateddk
smeeeigdvlfvlvclansldisleeahdrvmhkfntrdkdrwtrkeegk

Sequence, based on observed residues (ATOM records): (download)

>d2gtad1 a.204.1.2 (D:2-111) Hypothetical protein YpjD {Bacillus subtilis [TaxId: 1423]}
sdktmkdiqaevdryigqfkegyfsplammarlteelgelarevnhrygeksmeeeigdv
lfvlvclansldisleeahdrvmhkfntrkeegk

SCOP Domain Coordinates for d2gtad1:

Click to download the PDB-style file with coordinates for d2gtad1.
(The format of our PDB-style files is described here.)

Timeline for d2gtad1: