SCOPe 2.07: Domain d2gtac1: 2gta C:2-99

Lineage for d2gtac1 (2gta C:2-99)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
   multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer

4. Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families)
   basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat

5. Family a.204.1.2: MazG-like [116993] (4 proteins)
   Pfam PF03819

6. Protein Hypothetical protein YpjD [140790] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [140791] (1 PDB entry)
   Uniprot P42979 1-98

8. Domain d2gtac1: 2gta C:2-99 [135632]
   Other proteins in same PDB: d2gtad2
   complexed with na

Details for d2gtac1

PDB Entry: 2gta, 2.9 Å

PDB Description: crystal structure of the putative pyrophosphatase ypjd from bacillus subtilis. northeast structural genomics consortium target sr428.

PDB Compounds: (C:) Hypothetical protein ypjD

SCOPe Domain Sequences for d2gtac1:

Sequence, based on SEQRES records:

>d2gtac1 a.204.1.2 (C:2-99) Hypothetical protein YpjD {Bacillus subtilis [TaxId: 1423]}
sdktmkdiqaevdryigqfkegyfsplammarlteelgelarevnhrygekpkkateddk
smeeeigdvlfvlvclansldisleeahdrvmhkfntr

Sequence, based on observed residues (ATOM records):

>d2gtac1 a.204.1.2 (C:2-99) Hypothetical protein YpjD {Bacillus subtilis [TaxId: 1423]}
sdktmkdiqaevdryigqfkegyfsplammarlteelgelarevnhrysmeeeigdvlfv
lvclansldisleeahdrvmhkfntr

Timeline for d2gtac1:

• d2gtac1 first appeared in SCOP 1.73
  
• d2gtac1 appears in SCOPe 2.06
  
• d2gtac1 appears in the current release, SCOPe 2.08