| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily) multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer |
Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (4 families) ![]() basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat |
| Family a.204.1.2: MazG-like [116993] (3 proteins) Pfam PF03819 |
| Protein Hypothetical protein YpjD [140790] (1 species) |
| Species Bacillus subtilis [TaxId:1423] [140791] (1 PDB entry) |
| Domain d2gtab1: 2gta B:1-100 [135631] |
PDB Entry: 2gta (more details), 2.9 Å
SCOP Domain Sequences for d2gtab1:
Sequence, based on SEQRES records: (download)
>d2gtab1 a.204.1.2 (B:1-100) Hypothetical protein YpjD {Bacillus subtilis [TaxId: 1423]}
msdktmkdiqaevdryigqfkegyfsplammarlteelgelarevnhrygekpkkatedd
ksmeeeigdvlfvlvclansldisleeahdrvmhkfntrd
>d2gtab1 a.204.1.2 (B:1-100) Hypothetical protein YpjD {Bacillus subtilis [TaxId: 1423]}
msdktmkdiqaevdryigqfkegyfsplammarlteelgelarevnhrygekpkkaksme
eeigdvlfvlvclansldisleeahdrvmhkfntrd
Timeline for d2gtab1: