Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (328 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
Domain d2gt9e_: 2gt9 E: [135629] Other proteins in same PDB: d2gt9a1, d2gt9a2, d2gt9d1, d2gt9d2 automated match to d1a9bb_ complexed with gol, na |
PDB Entry: 2gt9 (more details), 1.75 Å
SCOPe Domain Sequences for d2gt9e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gt9e_ b.1.1.2 (E:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d2gt9e_: