Lineage for d2gt9d1 (2gt9 D:182-275)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1106699Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 1106700Species Human (Homo sapiens) [TaxId:9606] [88605] (157 PDB entries)
    Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
  8. 1106734Domain d2gt9d1: 2gt9 D:182-275 [135627]
    Other proteins in same PDB: d2gt9a2, d2gt9b_, d2gt9d2, d2gt9e_
    automatically matched to d1akja1
    complexed with gol, na

Details for d2gt9d1

PDB Entry: 2gt9 (more details), 1.75 Å

PDB Description: Human Class I MHC HLA-A2 in complex with the decameric Melan-A/MART-1(26-35) peptide
PDB Compounds: (D:) hla class I histocompatibility antigen

SCOPe Domain Sequences for d2gt9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gt9d1 b.1.1.2 (D:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

SCOPe Domain Coordinates for d2gt9d1:

Click to download the PDB-style file with coordinates for d2gt9d1.
(The format of our PDB-style files is described here.)

Timeline for d2gt9d1: