Lineage for d2gt3a_ (2gt3 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2197629Superfamily d.58.28: Peptide methionine sulfoxide reductase [55068] (2 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2197630Family d.58.28.1: Peptide methionine sulfoxide reductase [55069] (2 proteins)
  6. 2197645Protein automated matches [194683] (2 species)
    not a true protein
  7. 2197646Species Escherichia coli [TaxId:562] [255193] (1 PDB entry)
  8. 2197647Domain d2gt3a_: 2gt3 A: [135623]
    automated match to d1ff3a_

Details for d2gt3a_

PDB Entry: 2gt3 (more details)

PDB Description: Solution structure and dynamics of the reduced form of Methionine Sulfoxide Reductase A from Escherichia coli, a 23 kDa protein
PDB Compounds: (A:) Methionine Sulfoxide Reductase A

SCOPe Domain Sequences for d2gt3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gt3a_ d.58.28.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
slfdkkhlvspadalpgrntpmpvatlhavnghsmtnvpdgmeiaifamgcfwgverlfw
qlpgvystaagytggytpnptyrevcsgdtghaeavrivydpsvisyeqllqvfwenhdp
aqgmrqgndhgtqyrsaiypltpeqdaaaraslerfqaamlaadddrhitteianatpfy
yaeddhqqylhknpygycgiggigvclppea

SCOPe Domain Coordinates for d2gt3a_:

Click to download the PDB-style file with coordinates for d2gt3a_.
(The format of our PDB-style files is described here.)

Timeline for d2gt3a_: