Lineage for d2gt2b_ (2gt2 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535539Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2535540Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2535855Family d.113.1.5: GDP-mannose mannosyl hydrolase NudD [111132] (2 proteins)
  6. 2535856Protein GDP-mannose mannosyl hydrolase NudD [111133] (1 species)
  7. 2535857Species Escherichia coli [TaxId:562] [111134] (3 PDB entries)
    Uniprot P32056
  8. 2535861Domain d2gt2b_: 2gt2 B: [135620]
    automated match to d1ryaa_

Details for d2gt2b_

PDB Entry: 2gt2 (more details), 2 Å

PDB Description: structure of the e. coli gdp-mannose mannosyl hydrolase
PDB Compounds: (B:) GDP-mannose mannosyl hydrolase

SCOPe Domain Sequences for d2gt2b_:

Sequence, based on SEQRES records: (download)

>d2gt2b_ d.113.1.5 (B:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]}
rqedfatvvrstplvsldfivensrgefllgkrtnrpaqgywfvpggrvqkdetleaafe
rltmaelglrlpitagqfygvwqhfyddnfsgtdftthyvvlgfrfrvseeelllpdeqh
ddyrwltsdallasdnvhansrayflaekrtgvpgl

Sequence, based on observed residues (ATOM records): (download)

>d2gt2b_ d.113.1.5 (B:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]}
rqedfatvvrstplvsldfivensrgefllgkrtnrpaqgywfvpggrvqkdetleaafe
rltmaelglrlpitagqfygvwqhfyddnfsgtdftthyvvlgfrfrvseeellldyrwl
tsdallasdnvhansrayflaekrtgvpgl

SCOPe Domain Coordinates for d2gt2b_:

Click to download the PDB-style file with coordinates for d2gt2b_.
(The format of our PDB-style files is described here.)

Timeline for d2gt2b_: