SCOPe 2.08: Domain d2gt2b_: 2gt2 B:

Lineage for d2gt2b_ (2gt2 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.5: GDP-mannose mannosyl hydrolase NudD [111132] (2 proteins)

6. Protein GDP-mannose mannosyl hydrolase NudD [111133] (1 species)

7. Species Escherichia coli [TaxId:562] [111134] (3 PDB entries)
   Uniprot P32056

8. Domain d2gt2b_: 2gt2 B: [135620]
   automated match to d1ryaa_

Details for d2gt2b_

PDB Entry: 2gt2, 2 Å

PDB Description: structure of the e. coli gdp-mannose mannosyl hydrolase

PDB Compounds: (B:) GDP-mannose mannosyl hydrolase

SCOPe Domain Sequences for d2gt2b_:

Sequence, based on SEQRES records:

>d2gt2b_ d.113.1.5 (B:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]}
rqedfatvvrstplvsldfivensrgefllgkrtnrpaqgywfvpggrvqkdetleaafe
rltmaelglrlpitagqfygvwqhfyddnfsgtdftthyvvlgfrfrvseeelllpdeqh
ddyrwltsdallasdnvhansrayflaekrtgvpgl

Sequence, based on observed residues (ATOM records):

>d2gt2b_ d.113.1.5 (B:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]}
rqedfatvvrstplvsldfivensrgefllgkrtnrpaqgywfvpggrvqkdetleaafe
rltmaelglrlpitagqfygvwqhfyddnfsgtdftthyvvlgfrfrvseeellldyrwl
tsdallasdnvhansrayflaekrtgvpgl

Timeline for d2gt2b_:

• d2gt2b_ first appeared in SCOP 1.73, called d2gt2b1
  
• d2gt2b_ appears in SCOPe 2.07