Lineage for d2gt2a1 (2gt2 A:3-160)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 731929Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 731930Superfamily d.113.1: Nudix [55811] (7 families) (S)
  5. 732113Family d.113.1.5: GDP-mannose mannosyl hydrolase NudD [111132] (1 protein)
  6. 732114Protein GDP-mannose mannosyl hydrolase NudD [111133] (1 species)
  7. 732115Species Escherichia coli [TaxId:562] [111134] (2 PDB entries)
  8. 732118Domain d2gt2a1: 2gt2 A:3-160 [135619]
    automatically matched to d1ryaa_

Details for d2gt2a1

PDB Entry: 2gt2 (more details), 2 Å

PDB Description: structure of the e. coli gdp-mannose mannosyl hydrolase
PDB Compounds: (A:) GDP-mannose mannosyl hydrolase

SCOP Domain Sequences for d2gt2a1:

Sequence, based on SEQRES records: (download)

>d2gt2a1 d.113.1.5 (A:3-160) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]}
flrqedfatvvrstplvsldfivensrgefllgkrtnrpaqgywfvpggrvqkdetleaa
ferltmaelglrlpitagqfygvwqhfyddnfsgtdftthyvvlgfrfrvseeelllpde
qhddyrwltsdallasdnvhansrayflaekrtgvpgl

Sequence, based on observed residues (ATOM records): (download)

>d2gt2a1 d.113.1.5 (A:3-160) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]}
flrqedfatvvrstplvsldfivensrgefllgkrtnrpaqgywfvpggrvqkdetleaa
ferltmaelglrlpitagqfygvwqhfyddnfsgtdftthyvvlgfrfrvseeelldyrw
ltsdallasdnvhansrayflaekrtgvpgl

SCOP Domain Coordinates for d2gt2a1:

Click to download the PDB-style file with coordinates for d2gt2a1.
(The format of our PDB-style files is described here.)

Timeline for d2gt2a1: