Lineage for d2gt2a_ (2gt2 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971742Family d.113.1.5: GDP-mannose mannosyl hydrolase NudD [111132] (2 proteins)
  6. 2971743Protein GDP-mannose mannosyl hydrolase NudD [111133] (1 species)
  7. 2971744Species Escherichia coli [TaxId:562] [111134] (3 PDB entries)
    Uniprot P32056
  8. 2971750Domain d2gt2a_: 2gt2 A: [135619]
    automated match to d1ryaa_

Details for d2gt2a_

PDB Entry: 2gt2 (more details), 2 Å

PDB Description: structure of the e. coli gdp-mannose mannosyl hydrolase
PDB Compounds: (A:) GDP-mannose mannosyl hydrolase

SCOPe Domain Sequences for d2gt2a_:

Sequence, based on SEQRES records: (download)

>d2gt2a_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]}
flrqedfatvvrstplvsldfivensrgefllgkrtnrpaqgywfvpggrvqkdetleaa
ferltmaelglrlpitagqfygvwqhfyddnfsgtdftthyvvlgfrfrvseeelllpde
qhddyrwltsdallasdnvhansrayflaekrtgvpgl

Sequence, based on observed residues (ATOM records): (download)

>d2gt2a_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]}
flrqedfatvvrstplvsldfivensrgefllgkrtnrpaqgywfvpggrvqkdetleaa
ferltmaelglrlpitagqfygvwqhfyddnfsgtdftthyvvlgfrfrvseeelldyrw
ltsdallasdnvhansrayflaekrtgvpgl

SCOPe Domain Coordinates for d2gt2a_:

Click to download the PDB-style file with coordinates for d2gt2a_.
(The format of our PDB-style files is described here.)

Timeline for d2gt2a_: