Lineage for d2gsyq_ (2gsy Q:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. Family b.121.4.9: Birnaviridae-like VP [141109] (2 proteins)
    dsRNA virus but unlike the other dsRNA viruses has a genomic arrangement and genomic replication strategy similar to +sRNA viruses; includes Pfam PF01766; Birnavirus VP2 protein
  6. Protein automated matches [190599] (2 species)
    not a true protein
  7. Species Infectious bursal disease virus [TaxId:10995] [187617] (2 PDB entries)
  8. Domain d2gsyq_: 2gsy Q: [135615]
    Other proteins in same PDB: d2gsya1
    automated match to d2gsya1
    complexed with ca

Details for d2gsyq_

PDB Entry: 2gsy (more details), 2.6 Å

PDB Description: The 2.6A structure of Infectious Bursal Virus Derived T=1 Particles
PDB Compounds: (Q:) Polyprotein

SCOPe Domain Sequences for d2gsyq_:

Sequence, based on SEQRES records: (download)

>d2gsyq_ b.121.4.9 (Q:) automated matches {Infectious bursal disease virus [TaxId: 10995]}
tqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsi
vgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyalngtinav
tfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipai
gldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelv
frtsvhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpits
ikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvag
vsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfm
evadlnsplkiag

Sequence, based on observed residues (ATOM records): (download)

>d2gsyq_ b.121.4.9 (Q:) automated matches {Infectious bursal disease virus [TaxId: 10995]}
tqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsi
vgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpglngtinavtfqg
slseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldp
kmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrts
vhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsikle
ivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsnf
elipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfmevad
lnsplkiag

SCOPe Domain Coordinates for d2gsyq_ are not available.

Timeline for d2gsyq_:

Domains from other chains:
(mouse over for more information)
d2gsya1, d2gsyb_, d2gsyc_, d2gsyd_, d2gsye_, d2gsyf_, d2gsyg_, d2gsyh_, d2gsyi_, d2gsyj_, d2gsyk_, d2gsyl_, d2gsym_, d2gsyn_, d2gsyo_, d2gsyp_, d2gsyr_, d2gsys_, d2gsyt_