Lineage for d2gsyf_ (2gsy F:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1812227Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1812436Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 1812954Family b.121.4.9: Birnaviridae-like VP [141109] (2 proteins)
    dsRNA virus but unlike the other dsRNA viruses has a genomic arrangement and genomic replication strategy similar to +sRNA viruses; includes Pfam PF01766; Birnavirus VP2 protein
  6. 1812960Protein automated matches [190599] (2 species)
    not a true protein
  7. 1812963Species Infectious bursal disease virus [TaxId:10995] [187617] (2 PDB entries)
  8. 1812987Domain d2gsyf_: 2gsy F: [135604]
    Other proteins in same PDB: d2gsya1
    automated match to d2gsya1
    complexed with ca

Details for d2gsyf_

PDB Entry: 2gsy (more details), 2.6 Å

PDB Description: The 2.6A structure of Infectious Bursal Virus Derived T=1 Particles
PDB Compounds: (F:) Polyprotein

SCOPe Domain Sequences for d2gsyf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gsyf_ b.121.4.9 (F:) automated matches {Infectious bursal disease virus [TaxId: 10995]}
tqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsi
vgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyalngtinav
tfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipai
gldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelv
frtsvhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpits
ikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvag
vsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfm
evadlnsplkiag

SCOPe Domain Coordinates for d2gsyf_:

Click to download the PDB-style file with coordinates for d2gsyf_.
(The format of our PDB-style files is described here.)

Timeline for d2gsyf_: