Lineage for d2gsya1 (2gsy A:8-440)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075417Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2075626Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2076147Family b.121.4.9: Birnaviridae-like VP [141109] (2 protein domains)
    dsRNA virus but unlike the other dsRNA viruses has a genomic arrangement and genomic replication strategy similar to +sRNA viruses; includes Pfam PF01766; Birnavirus VP2 protein
  6. 2076148Protein Birnavirus VP2 [141110] (1 species)
    Link between +sRNA and dsRNA viruses two domains - the first similar to (88633) and the second, insert domain is similar to (49818). dsRNA virus but unlike the other dsRNA viruses has a genomic arrangement and genomic replication strategy similar to +sRNA viruses
  7. 2076149Species Infectious bursal disease virus [TaxId:10995] [141111] (3 PDB entries)
    Uniprot P15480 11-431! Uniprot P61825 8-440! Uniprot Q6S9I7 11-429
  8. 2076151Domain d2gsya1: 2gsy A:8-440 [135599]
    Other proteins in same PDB: d2gsyb_, d2gsyc_, d2gsyd_, d2gsye_, d2gsyf_, d2gsyg_, d2gsyh_, d2gsyi_, d2gsyj_, d2gsyk_, d2gsyl_, d2gsym_, d2gsyn_, d2gsyo_, d2gsyp_, d2gsyq_, d2gsyr_, d2gsys_, d2gsyt_
    complexed with ca

Details for d2gsya1

PDB Entry: 2gsy (more details), 2.6 Å

PDB Description: The 2.6A structure of Infectious Bursal Virus Derived T=1 Particles
PDB Compounds: (A:) Polyprotein

SCOPe Domain Sequences for d2gsya1:

Sequence, based on SEQRES records: (download)

>d2gsya1 b.121.4.9 (A:8-440) Birnavirus VP2 {Infectious bursal disease virus [TaxId: 10995]}
tqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsi
vgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyalngtinav
tfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipai
gldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelv
frtsvhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpits
ikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvag
vsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfm
evadlnsplkiag

Sequence, based on observed residues (ATOM records): (download)

>d2gsya1 b.121.4.9 (A:8-440) Birnavirus VP2 {Infectious bursal disease virus [TaxId: 10995]}
tqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsi
vgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlplngtinavtfqgs
lseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldpk
mvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrtsv
hglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsiklei
vtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsnfe
lipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfmevadl
nsplkiag

SCOPe Domain Coordinates for d2gsya1:

Click to download the PDB-style file with coordinates for d2gsya1.
(The format of our PDB-style files is described here.)

Timeline for d2gsya1: