Lineage for d2gswc1 (2gsw C:3-170)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825505Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 825904Superfamily c.23.5: Flavoproteins [52218] (8 families) (S)
  5. 826125Family c.23.5.4: NADPH-dependent FMN reductase [89590] (4 proteins)
    Pfam PF03358
  6. 826126Protein Azobenzene reductase [89591] (1 species)
  7. 826127Species Bacillus subtilis [TaxId:1423] [89592] (2 PDB entries)
    YhdA gene product
  8. 826131Domain d2gswc1: 2gsw C:3-170 [135597]
    automatically matched to d1nni1_
    complexed with fmn

Details for d2gswc1

PDB Entry: 2gsw (more details), 2.92 Å

PDB Description: Crystal Structure of the Putative NADPH-dependent Azobenzene FMN-Reductase YhdA from Bacillus subtilis, Northeast Structural Genomics Target SR135
PDB Compounds: (C:) yhdA

SCOP Domain Sequences for d2gswc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gswc1 c.23.5.4 (C:3-170) Azobenzene reductase {Bacillus subtilis [TaxId: 1423]}
mlvingtprkhgrtriaasyiaalyhtdlidlsefvlpvfngeaeqsellkvqelkqrvt
kadaivllspeyhsgmsgalknaldflsseqfkykpvallavagggkgginalnnmrtvm
rgvyanvipkqlvldpvhidvenatvaenikesikelveelsmfakag

SCOP Domain Coordinates for d2gswc1:

Click to download the PDB-style file with coordinates for d2gswc1.
(The format of our PDB-style files is described here.)

Timeline for d2gswc1: