SCOP 1.73: Domain d2gswc1: 2gsw C:3-170

Lineage for d2gswc1 (2gsw C:3-170)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (8 families)

5. Family c.23.5.4: NADPH-dependent FMN reductase [89590] (4 proteins)
   Pfam PF03358

6. Protein Azobenzene reductase [89591] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [89592] (2 PDB entries)
   YhdA gene product

8. Domain d2gswc1: 2gsw C:3-170 [135597]
   automatically matched to d1nni1_
   complexed with fmn

Details for d2gswc1

PDB Entry: 2gsw, 2.92 Å

PDB Description: Crystal Structure of the Putative NADPH-dependent Azobenzene FMN-Reductase YhdA from Bacillus subtilis, Northeast Structural Genomics Target SR135

PDB Compounds: (C:) yhdA

SCOP Domain Sequences for d2gswc1:

Sequence; same for both SEQRES and ATOM records:

>d2gswc1 c.23.5.4 (C:3-170) Azobenzene reductase {Bacillus subtilis [TaxId: 1423]}
mlvingtprkhgrtriaasyiaalyhtdlidlsefvlpvfngeaeqsellkvqelkqrvt
kadaivllspeyhsgmsgalknaldflsseqfkykpvallavagggkgginalnnmrtvm
rgvyanvipkqlvldpvhidvenatvaenikesikelveelsmfakag

Timeline for d2gswc1:

• d2gswc1 is new in SCOP 1.73
  
• d2gswc1 appears in SCOP 1.75
  
• d2gswc1 appears in the current release, SCOPe 2.08, called d2gswc_