![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.5: Flavoproteins [52218] (8 families) ![]() |
![]() | Family c.23.5.4: NADPH-dependent FMN reductase [89590] (4 proteins) Pfam PF03358 |
![]() | Protein Azobenzene reductase [89591] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [89592] (2 PDB entries) YhdA gene product |
![]() | Domain d2gswb1: 2gsw B:3-170 [135596] automatically matched to d1nni1_ complexed with fmn |
PDB Entry: 2gsw (more details), 2.92 Å
SCOP Domain Sequences for d2gswb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gswb1 c.23.5.4 (B:3-170) Azobenzene reductase {Bacillus subtilis [TaxId: 1423]} mlvingtprkhgrtriaasyiaalyhtdlidlsefvlpvfngeaeqsellkvqelkqrvt kadaivllspeyhsgmsgalknaldflsseqfkykpvallavagggkgginalnnmrtvm rgvyanvipkqlvldpvhidvenatvaenikesikelveelsmfakag
Timeline for d2gswb1: