SCOPe 2.08: Domain d2gswb_: 2gsw B:

Lineage for d2gswb_ (2gsw B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.4: NADPH-dependent FMN reductase [89590] (5 proteins)
   Pfam PF03358

6. Protein Azobenzene reductase [89591] (2 species)

7. Species Bacillus subtilis [TaxId:224308] [187123] (1 PDB entry)

8. Domain d2gswb_: 2gsw B: [135596]
   automated match to d1nni1_
   complexed with fmn

Details for d2gswb_

PDB Entry: 2gsw, 2.92 Å

PDB Description: Crystal Structure of the Putative NADPH-dependent Azobenzene FMN-Reductase YhdA from Bacillus subtilis, Northeast Structural Genomics Target SR135

PDB Compounds: (B:) yhdA

SCOPe Domain Sequences for d2gswb_:

Sequence; same for both SEQRES and ATOM records:

>d2gswb_ c.23.5.4 (B:) Azobenzene reductase {Bacillus subtilis [TaxId: 224308]}
mlvingtprkhgrtriaasyiaalyhtdlidlsefvlpvfngeaeqsellkvqelkqrvt
kadaivllspeyhsgmsgalknaldflsseqfkykpvallavagggkgginalnnmrtvm
rgvyanvipkqlvldpvhidvenatvaenikesikelveelsmfakag

Timeline for d2gswb_:

• d2gswb_ first appeared in SCOP 1.73, called d2gswb1
  
• d2gswb_ appears in SCOPe 2.07