Lineage for d2gsmd2 (2gsm D:30-129)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745255Fold f.17: Transmembrane helix hairpin [81334] (3 superfamilies)
    two antiparallel transmembrane helices
  4. 745277Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family) (S)
  5. 745278Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins)
  6. 745279Protein Bacterial aa3 type cytochrome c oxidase subunit II [81458] (2 species)
  7. 745283Species Rhodobacter sphaeroides [TaxId:1063] [81457] (3 PDB entries)
  8. 745285Domain d2gsmd2: 2gsm D:30-129 [135594]
    Other proteins in same PDB: d2gsma1, d2gsmb1, d2gsmc1, d2gsmd1
    automatically matched to d1m56b2
    complexed with ca, cd, cu, dmu, hea, mg, oh, trd

Details for d2gsmd2

PDB Entry: 2gsm (more details), 2 Å

PDB Description: catalytic core (subunits i and ii) of cytochrome c oxidase from rhodobacter sphaeroides
PDB Compounds: (D:) Cytochrome c oxidase subunit 2

SCOP Domain Sequences for d2gsmd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gsmd2 f.17.2.1 (D:30-129) Bacterial aa3 type cytochrome c oxidase subunit II {Rhodobacter sphaeroides [TaxId: 1063]}
leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk
vparfthnspleiawtivpivilvaigafslpvlfnqqei

SCOP Domain Coordinates for d2gsmd2:

Click to download the PDB-style file with coordinates for d2gsmd2.
(The format of our PDB-style files is described here.)

Timeline for d2gsmd2: