Lineage for d2gsmd2 (2gsm D:30-129)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023860Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 3024004Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 3024005Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 3024006Protein Bacterial aa3 type cytochrome c oxidase subunit II [81458] (2 species)
  7. 3024012Species Rhodobacter sphaeroides [TaxId:1063] [81457] (7 PDB entries)
  8. 3024014Domain d2gsmd2: 2gsm D:30-129 [135594]
    Other proteins in same PDB: d2gsma_, d2gsmb1, d2gsmb3, d2gsmc_, d2gsmd1, d2gsmd3
    automated match to d3fyeb1
    complexed with ca, cd, cu, dmu, hea, mg, oh, trd

Details for d2gsmd2

PDB Entry: 2gsm (more details), 2 Å

PDB Description: catalytic core (subunits i and ii) of cytochrome c oxidase from rhodobacter sphaeroides
PDB Compounds: (D:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d2gsmd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gsmd2 f.17.2.1 (D:30-129) Bacterial aa3 type cytochrome c oxidase subunit II {Rhodobacter sphaeroides [TaxId: 1063]}
leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk
vparfthnspleiawtivpivilvaigafslpvlfnqqei

SCOPe Domain Coordinates for d2gsmd2:

Click to download the PDB-style file with coordinates for d2gsmd2.
(The format of our PDB-style files is described here.)

Timeline for d2gsmd2: