![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily) 12 transmembrane helices in an approximate threefold rotational symmetric arrangement |
![]() | Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) ![]() |
![]() | Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins) the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3 |
![]() | Protein Bacterial aa3 type cytochrome c oxidase subunit I [81436] (2 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [81435] (6 PDB entries) |
![]() | Domain d2gsmc_: 2gsm C: [135592] Other proteins in same PDB: d2gsmb1, d2gsmb2, d2gsmb3, d2gsmd1, d2gsmd2, d2gsmd3 automated match to d1m56a_ complexed with ca, cd, cu, dmu, hea, mg, oh, trd |
PDB Entry: 2gsm (more details), 2 Å
SCOPe Domain Sequences for d2gsmc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gsmc_ f.24.1.1 (C:) Bacterial aa3 type cytochrome c oxidase subunit I {Rhodobacter sphaeroides [TaxId: 1063]} ftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglvkgf fqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdmafp rmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifavhl sgassilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitmlltd rnfgttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgylpm vyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwggsie lktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgifagi yfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatwnfv sslgaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppeht
Timeline for d2gsmc_: