SCOP 1.73: Domain d2gsmb2: 2gsm B:30-129

Lineage for d2gsmb2 (2gsm B:30-129)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (3 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins)

6. Protein Bacterial aa3 type cytochrome c oxidase subunit II [81458] (2 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81457] (3 PDB entries)

8. Domain d2gsmb2: 2gsm B:30-129 [135591]
   Other proteins in same PDB: d2gsma1, d2gsmb1, d2gsmc1, d2gsmd1
   automatically matched to d1m56b2
   complexed with ca, cd, cu, dmu, hea, mg, oh, trd

Details for d2gsmb2

PDB Entry: 2gsm, 2 Å

PDB Description: catalytic core (subunits i and ii) of cytochrome c oxidase from rhodobacter sphaeroides

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOP Domain Sequences for d2gsmb2:

Sequence; same for both SEQRES and ATOM records:

>d2gsmb2 f.17.2.1 (B:30-129) Bacterial aa3 type cytochrome c oxidase subunit II {Rhodobacter sphaeroides [TaxId: 1063]}
leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk
vparfthnspleiawtivpivilvaigafslpvlfnqqei

Timeline for d2gsmb2:

• d2gsmb2 is new in SCOP 1.73
  
• d2gsmb2 appears in SCOP 1.75
  
• d2gsmb2 appears in the current release, SCOPe 2.08