Lineage for d2gsmb1 (2gsm B:130-281)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771043Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 2771044Protein Cytochrome c oxidase [49544] (4 species)
  7. 2771145Species Rhodobacter sphaeroides [TaxId:1063] [74870] (7 PDB entries)
  8. 2771146Domain d2gsmb1: 2gsm B:130-281 [135590]
    Other proteins in same PDB: d2gsma_, d2gsmb2, d2gsmb3, d2gsmc_, d2gsmd2, d2gsmd3
    automated match to d3fyeb2
    complexed with ca, cd, cu, dmu, hea, mg, oh, trd

Details for d2gsmb1

PDB Entry: 2gsm (more details), 2 Å

PDB Description: catalytic core (subunits i and ii) of cytochrome c oxidase from rhodobacter sphaeroides
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d2gsmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gsmb1 b.6.1.2 (B:130-281) Cytochrome c oxidase {Rhodobacter sphaeroides [TaxId: 1063]}
peadvtvkvtgyqwywgyeypdeeisfesymigspatggdnrmspeveqqlieagysrde
fllatdtamvvpvnktvvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiff
gqcselcgishaympitvkvvseeayaawleq

SCOPe Domain Coordinates for d2gsmb1:

Click to download the PDB-style file with coordinates for d2gsmb1.
(The format of our PDB-style files is described here.)

Timeline for d2gsmb1: