SCOPe 2.08: Domain d2gsma_: 2gsm A:

Lineage for d2gsma_ (2gsm A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
   12 transmembrane helices in an approximate threefold rotational symmetric arrangement

4. Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family)

5. Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
   the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3

6. Protein Bacterial aa3 type cytochrome c oxidase subunit I [81436] (2 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81435] (7 PDB entries)

8. Domain d2gsma_: 2gsm A: [135589]
   Other proteins in same PDB: d2gsmb1, d2gsmb2, d2gsmb3, d2gsmd1, d2gsmd2, d2gsmd3
   automated match to d1m56a_
   complexed with ca, cd, cu, dmu, hea, mg, oh, trd

Details for d2gsma_

PDB Entry: 2gsm, 2 Å

PDB Description: catalytic core (subunits i and ii) of cytochrome c oxidase from rhodobacter sphaeroides

PDB Compounds: (A:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d2gsma_:

Sequence; same for both SEQRES and ATOM records:

>d2gsma_ f.24.1.1 (A:) Bacterial aa3 type cytochrome c oxidase subunit I {Rhodobacter sphaeroides [TaxId: 1063]}
ftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglvkgf
fqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdmafp
rmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifavhl
sgassilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitmlltd
rnfgttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgylpm
vyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwggsie
lktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgifagi
yfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatwnfv
sslgaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppehtf

Timeline for d2gsma_:

• d2gsma_ first appeared in SCOP 1.73, called d2gsma1
  
• d2gsma_ appears in SCOPe 2.07