![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.212: TolA/TonB C-terminal domain [74652] (1 superfamily) beta(2)-alpha-beta; 2 layers, alpha/beta; left-handed beta-alpha-beta unit in non-swapped monomer |
![]() | Superfamily d.212.1: TolA/TonB C-terminal domain [74653] (3 families) ![]() |
![]() | Family d.212.1.2: TonB [64326] (1 protein) isolated domain can form different segment-swapped dimers depending on the fragment length automatically mapped to Pfam PF03544 |
![]() | Protein TonB [64327] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [64328] (6 PDB entries) Uniprot P02929 150-239 |
![]() | Domain d2gskb_: 2gsk B: [135588] Other proteins in same PDB: d2gska_ automated match to d1u07a_ complexed with ca, cnc, hex, lda, oct |
PDB Entry: 2gsk (more details), 2.1 Å
SCOPe Domain Sequences for d2gskb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gskb_ d.212.1.2 (B:) TonB {Escherichia coli [TaxId: 562]} pralsrnqpqyparaqalriegqvkvkfdvtpdgrvdnvqilsakpanmferevknamrr wryepgkpgsgivvnilfkin
Timeline for d2gskb_: