SCOPe 2.08: Domain d2gskb_: 2gsk B:

Lineage for d2gskb_ (2gsk B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.212: TolA/TonB C-terminal domain [74652] (1 superfamily)
   beta(2)-alpha-beta; 2 layers, alpha/beta; left-handed beta-alpha-beta unit in non-swapped monomer

4. Superfamily d.212.1: TolA/TonB C-terminal domain [74653] (3 families)

5. Family d.212.1.2: TonB [64326] (1 protein)
   isolated domain can form different segment-swapped dimers depending on the fragment length
   automatically mapped to Pfam PF03544

6. Protein TonB [64327] (1 species)

7. Species Escherichia coli [TaxId:562] [64328] (6 PDB entries)
   Uniprot P02929 150-239

8. Domain d2gskb_: 2gsk B: [135588]
   Other proteins in same PDB: d2gska_
   automated match to d1u07a_
   complexed with ca, cnc, hex, lda, oct

Details for d2gskb_

PDB Entry: 2gsk, 2.1 Å

PDB Description: structure of the btub:tonb complex

PDB Compounds: (B:) Protein tonB

SCOPe Domain Sequences for d2gskb_:

Sequence; same for both SEQRES and ATOM records:

>d2gskb_ d.212.1.2 (B:) TonB {Escherichia coli [TaxId: 562]}
pralsrnqpqyparaqalriegqvkvkfdvtpdgrvdnvqilsakpanmferevknamrr
wryepgkpgsgivvnilfkin

Timeline for d2gskb_:

• d2gskb_ first appeared in SCOP 1.73, called d2gskb1
  
• d2gskb_ appears in SCOPe 2.07