SCOPe 2.08: Domain d2gsig2: 2gsi G:108-211

Lineage for d2gsig2 (2gsi G:108-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (374 PDB entries)
   Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region

8. Domain d2gsig2: 2gsi G:108-211 [135586]
   Other proteins in same PDB: d2gsia1, d2gsib1, d2gsib2, d2gsic1, d2gsid1, d2gsid2, d2gsie1, d2gsif1, d2gsif2, d2gsig1, d2gsih1, d2gsih2
   automatically matched to d1egjl2
   complexed with na

Details for d2gsig2

PDB Entry: 2gsi, 2.81 Å

PDB Description: crystal structure of a murine fab in complex with an 11 residue peptide derived from staphylococcal nuclease

PDB Compounds: (G:) Immunoglobulin (kappa) light chain

SCOPe Domain Sequences for d2gsig2:

Sequence; same for both SEQRES and ATOM records:

>d2gsig2 b.1.1.2 (G:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d2gsig2:

• d2gsig2 first appeared in SCOP 1.73
  
• d2gsig2 appears in SCOPe 2.07