SCOP 1.73: Domain d2gsie2: 2gsi E:108-211

Lineage for d2gsie2 (2gsi E:108-211)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)

8. Domain d2gsie2: 2gsi E:108-211 [135584]
   Other proteins in same PDB: d2gsia1, d2gsic1, d2gsie1, d2gsig1
   automatically matched to d1egjl2
   complexed with na

Details for d2gsie2

PDB Entry: 2gsi, 2.81 Å

PDB Description: crystal structure of a murine fab in complex with an 11 residue peptide derived from staphylococcal nuclease

PDB Compounds: (E:) Immunoglobulin (kappa) light chain

SCOP Domain Sequences for d2gsie2:

Sequence; same for both SEQRES and ATOM records:

>d2gsie2 b.1.1.2 (E:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d2gsie2:

• d2gsie2 is new in SCOP 1.73
  
• d2gsie2 appears in SCOP 1.75
  
• d2gsie2 appears in the current release, SCOPe 2.08