SCOP 1.73: Domain d2gsie1: 2gsi E:1-107

Lineage for d2gsie1 (2gsi E:1-107)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (28 PDB entries)

8. Domain d2gsie1: 2gsi E:1-107 [135583]
   Other proteins in same PDB: d2gsia2, d2gsic2, d2gsie2, d2gsig2
   automatically matched to d1egjl1
   complexed with na

Details for d2gsie1

PDB Entry: 2gsi, 2.81 Å

PDB Description: crystal structure of a murine fab in complex with an 11 residue peptide derived from staphylococcal nuclease

PDB Compounds: (E:) Immunoglobulin (kappa) light chain

SCOP Domain Sequences for d2gsie1:

Sequence; same for both SEQRES and ATOM records:

>d2gsie1 b.1.1.1 (E:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]}
divltqspaslavslgqpatiscgasksvrtsgysymdwnqqkpgqpprrliylvsnles
gvparfsgsgsgtdftlnihpveeedaatyycshirelprssgggtkleik

Timeline for d2gsie1:

• d2gsie1 is new in SCOP 1.73
  
• d2gsie1 appears in SCOP 1.75
  
• d2gsie1 appears in the current release, SCOPe 2.08