Lineage for d2gsia1 (2gsi A:1-107)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653386Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (28 PDB entries)
  8. 653412Domain d2gsia1: 2gsi A:1-107 [135579]
    Other proteins in same PDB: d2gsia2, d2gsic2, d2gsie2, d2gsig2
    automatically matched to d1egjl1
    complexed with na

Details for d2gsia1

PDB Entry: 2gsi (more details), 2.81 Å

PDB Description: crystal structure of a murine fab in complex with an 11 residue peptide derived from staphylococcal nuclease
PDB Compounds: (A:) Immunoglobulin (kappa) light chain

SCOP Domain Sequences for d2gsia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gsia1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]}
divltqspaslavslgqpatiscgasksvrtsgysymdwnqqkpgqpprrliylvsnles
gvparfsgsgsgtdftlnihpveeedaatyycshirelprssgggtkleik

SCOP Domain Coordinates for d2gsia1:

Click to download the PDB-style file with coordinates for d2gsia1.
(The format of our PDB-style files is described here.)

Timeline for d2gsia1: