Lineage for d2gs6a1 (2gs6 A:672-994)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 735132Protein EGF receptor tyrosine kinase, Erbb-1 [82795] (1 species)
    PTK group; EGFR subfamily; membrane spanning protein tyrosine kinase
  7. 735133Species Human (Homo sapiens) [TaxId:9606] [82796] (10 PDB entries)
  8. 735135Domain d2gs6a1: 2gs6 A:672-994 [135578]
    automatically matched to d1m14a_
    complexed with 112, cl

Details for d2gs6a1

PDB Entry: 2gs6 (more details), 2.6 Å

PDB Description: crystal structure of the active egfr kinase domain in complex with an atp analog-peptide conjugate
PDB Compounds: (A:) Epidermal growth factor receptor

SCOP Domain Sequences for d2gs6a1:

Sequence, based on SEQRES records: (download)

>d2gs6a1 d.144.1.7 (A:672-994) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
geapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspka
nkeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyll
nwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggk
vpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpq
ppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptds
nfyralmdeedmddvvdadeyli

Sequence, based on observed residues (ATOM records): (download)

>d2gs6a1 d.144.1.7 (A:672-994) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
geapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikeltspkanke
ildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwc
vqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkvpi
kwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppi
ctidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsedmddvv
dadeyli

SCOP Domain Coordinates for d2gs6a1:

Click to download the PDB-style file with coordinates for d2gs6a1.
(The format of our PDB-style files is described here.)

Timeline for d2gs6a1: