Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.4: YciF-like [140445] (3 proteins) Pfam PF05974; DUF892 |
Protein Hypothetical protein YciF [140448] (1 species) |
Species Escherichia coli [TaxId:562] [140449] (1 PDB entry) Uniprot P21362 3-161 |
Domain d2gs4b_: 2gs4 B: [135576] automated match to d2gs4a1 |
PDB Entry: 2gs4 (more details), 2 Å
SCOPe Domain Sequences for d2gs4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gs4b_ a.25.1.4 (B:) Hypothetical protein YciF {Escherichia coli [TaxId: 562]} ktiedvfihllsdtysaekqltralaklaratsneklsqafhahleethgqieridqvve sesnlkikrmkcvameglieeaneviesteknevrdaaliaaaqkvehyeiasygtlatl aeqlgyrkaakllketleeekatdikltdlainn
Timeline for d2gs4b_: