SCOPe 2.06: Domain d2gs4b_: 2gs4 B:

Lineage for d2gs4b_ (2gs4 B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.4: YciF-like [140445] (3 proteins)
   Pfam PF05974; DUF892

6. Protein Hypothetical protein YciF [140448] (1 species)

7. Species Escherichia coli [TaxId:562] [140449] (1 PDB entry)
   Uniprot P21362 3-161

8. Domain d2gs4b_: 2gs4 B: [135576]
   automated match to d2gs4a1

Details for d2gs4b_

PDB Entry: 2gs4, 2 Å

PDB Description: The crystal structure of the E.coli stress protein YciF.

PDB Compounds: (B:) Protein yciF

SCOPe Domain Sequences for d2gs4b_:

Sequence; same for both SEQRES and ATOM records:

>d2gs4b_ a.25.1.4 (B:) Hypothetical protein YciF {Escherichia coli [TaxId: 562]}
ktiedvfihllsdtysaekqltralaklaratsneklsqafhahleethgqieridqvve
sesnlkikrmkcvameglieeaneviesteknevrdaaliaaaqkvehyeiasygtlatl
aeqlgyrkaakllketleeekatdikltdlainn

Timeline for d2gs4b_:

• d2gs4b_ first appeared in SCOP 1.73, called d2gs4b1
  
• d2gs4b_ appears in SCOPe 2.05
  
• d2gs4b_ appears in SCOPe 2.07
  
• d2gs4b_ appears in the current release, SCOPe 2.08