SCOP 1.73: Domain d2gs4b1: 2gs4 B:4-157

Lineage for d2gs4b1 (2gs4 B:4-157)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.25: Ferritin-like [47239] (4 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (5 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.4: YciF-like [140445] (2 proteins)
   Pfam PF05974; DUF892

6. Protein Hypothetical protein YciF [140448] (1 species)

7. Species Escherichia coli [TaxId:562] [140449] (1 PDB entry)

8. Domain d2gs4b1: 2gs4 B:4-157 [135576]
   automatically matched to 2GS4 A:3-161

Details for d2gs4b1

PDB Entry: 2gs4, 2 Å

PDB Description: The crystal structure of the E.coli stress protein YciF.

PDB Compounds: (B:) Protein yciF

SCOP Domain Sequences for d2gs4b1:

Sequence; same for both SEQRES and ATOM records:

>d2gs4b1 a.25.1.4 (B:4-157) Hypothetical protein YciF {Escherichia coli [TaxId: 562]}
ktiedvfihllsdtysaekqltralaklaratsneklsqafhahleethgqieridqvve
sesnlkikrmkcvameglieeaneviesteknevrdaaliaaaqkvehyeiasygtlatl
aeqlgyrkaakllketleeekatdikltdlainn

Timeline for d2gs4b1:

• d2gs4b1 is new in SCOP 1.73
  
• d2gs4b1 appears in SCOP 1.75
  
• d2gs4b1 appears in the current release, SCOPe 2.08, called d2gs4b_