Lineage for d2gs4a1 (2gs4 A:3-161)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1991549Family a.25.1.4: YciF-like [140445] (3 proteins)
    Pfam PF05974; DUF892
  6. 1991550Protein Hypothetical protein YciF [140448] (1 species)
  7. 1991551Species Escherichia coli [TaxId:562] [140449] (1 PDB entry)
    Uniprot P21362 3-161
  8. 1991552Domain d2gs4a1: 2gs4 A:3-161 [135575]

Details for d2gs4a1

PDB Entry: 2gs4 (more details), 2 Å

PDB Description: The crystal structure of the E.coli stress protein YciF.
PDB Compounds: (A:) Protein yciF

SCOPe Domain Sequences for d2gs4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gs4a1 a.25.1.4 (A:3-161) Hypothetical protein YciF {Escherichia coli [TaxId: 562]}
mktiedvfihllsdtysaekqltralaklaratsneklsqafhahleethgqieridqvv
esesnlkikrmkcvameglieeaneviesteknevrdaaliaaaqkvehyeiasygtlat
laeqlgyrkaakllketleeekatdikltdlainnvnkk

SCOPe Domain Coordinates for d2gs4a1:

Click to download the PDB-style file with coordinates for d2gs4a1.
(The format of our PDB-style files is described here.)

Timeline for d2gs4a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2gs4b_