Lineage for d2gs0a_ (2gs0 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1550800Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1550801Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1551308Family b.55.1.9: TFIIH domain [110272] (2 proteins)
  6. 1551309Protein RNA polymerase II transcription factor B 73 kDa, TFB1 [141434] (2 species)
  7. 1551310Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141435] (6 PDB entries)
    Uniprot P32776 2-115
  8. 1551312Domain d2gs0a_: 2gs0 A: [135573]
    automated match to d1y5oa1

Details for d2gs0a_

PDB Entry: 2gs0 (more details)

PDB Description: nmr structure of the complex between the ph domain of the tfb1 subunit from tfiih and the activation domain of p53
PDB Compounds: (A:) RNA polymerase II transcription factor B subunit 1

SCOPe Domain Sequences for d2gs0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gs0a_ b.55.1.9 (A:) RNA polymerase II transcription factor B 73 kDa, TFB1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pshsgaaifekvsgiiainedvspaeltwrstdgdkvhtvvlstidklqatpassekmml
rligkvdeskkrkdnegnevvpkpqrhmfsfnnrtvmdnikmtlqqiisrykdad

SCOPe Domain Coordinates for d2gs0a_:

Click to download the PDB-style file with coordinates for d2gs0a_.
(The format of our PDB-style files is described here.)

Timeline for d2gs0a_: