Lineage for d2gs0a1 (2gs0 A:2-115)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 805150Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 805151Superfamily b.55.1: PH domain-like [50729] (13 families) (S)
  5. 805611Family b.55.1.9: TFIIH domain [110272] (2 proteins)
  6. 805612Protein RNA polymerase II transcription factor B 73 kDa, TFB1 [141434] (1 species)
  7. 805613Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141435] (3 PDB entries)
    Uniprot P32776 2-115
  8. 805615Domain d2gs0a1: 2gs0 A:2-115 [135573]
    automatically matched to 1Y5O A:2-115
    mutant

Details for d2gs0a1

PDB Entry: 2gs0 (more details)

PDB Description: nmr structure of the complex between the ph domain of the tfb1 subunit from tfiih and the activation domain of p53
PDB Compounds: (A:) RNA polymerase II transcription factor B subunit 1

SCOP Domain Sequences for d2gs0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gs0a1 b.55.1.9 (A:2-115) RNA polymerase II transcription factor B 73 kDa, TFB1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
shsgaaifekvsgiiainedvspaeltwrstdgdkvhtvvlstidklqatpassekmmlr
ligkvdeskkrkdnegnevvpkpqrhmfsfnnrtvmdnikmtlqqiisrykdad

SCOP Domain Coordinates for d2gs0a1:

Click to download the PDB-style file with coordinates for d2gs0a1.
(The format of our PDB-style files is described here.)

Timeline for d2gs0a1: