![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.9: TFIIH domain [110272] (3 proteins) |
![]() | Protein RNA polymerase II transcription factor B 73 kDa, TFB1 [141434] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141435] (9 PDB entries) Uniprot P32776 2-115 |
![]() | Domain d2gs0a_: 2gs0 A: [135573] automated match to d1y5oa1 |
PDB Entry: 2gs0 (more details)
SCOPe Domain Sequences for d2gs0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gs0a_ b.55.1.9 (A:) RNA polymerase II transcription factor B 73 kDa, TFB1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} pshsgaaifekvsgiiainedvspaeltwrstdgdkvhtvvlstidklqatpassekmml rligkvdeskkrkdnegnevvpkpqrhmfsfnnrtvmdnikmtlqqiisrykdad
Timeline for d2gs0a_: