Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.212: TolA/TonB C-terminal domain [74652] (1 superfamily) beta(2)-alpha-beta; 2 layers, alpha/beta; left-handed beta-alpha-beta unit in non-swapped monomer |
Superfamily d.212.1: TolA/TonB C-terminal domain [74653] (2 families) |
Family d.212.1.2: TonB [64326] (1 protein) isolated domain can form different segment-swapped dimers depending on the fragment length automatically mapped to Pfam PF03544 |
Protein TonB [64327] (1 species) |
Species Escherichia coli [TaxId:562] [64328] (6 PDB entries) Uniprot P02929 150-239 |
Domain d2grxd1: 2grx D:158-235 [135572] Other proteins in same PDB: d2grxa1, d2grxb1 automatically matched to d1u07a_ complexed with dao, dpo, eap, fci, ftt, myr, po4 |
PDB Entry: 2grx (more details), 3.3 Å
SCOPe Domain Sequences for d2grxd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2grxd1 d.212.1.2 (D:158-235) TonB {Escherichia coli [TaxId: 562]} rnqpqyparaqalriegqvkvkfdvtpdgrvdnvqilsakpanmferevknamrrwryep gkpgsgivvnilfkingt
Timeline for d2grxd1: