Lineage for d2grxc1 (2grx C:158-235)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006762Fold d.212: TolA/TonB C-terminal domain [74652] (1 superfamily)
    beta(2)-alpha-beta; 2 layers, alpha/beta; left-handed beta-alpha-beta unit in non-swapped monomer
  4. 3006763Superfamily d.212.1: TolA/TonB C-terminal domain [74653] (3 families) (S)
  5. 3006778Family d.212.1.2: TonB [64326] (1 protein)
    isolated domain can form different segment-swapped dimers depending on the fragment length
    automatically mapped to Pfam PF03544
  6. 3006779Protein TonB [64327] (1 species)
  7. 3006780Species Escherichia coli [TaxId:562] [64328] (6 PDB entries)
    Uniprot P02929 150-239
  8. 3006787Domain d2grxc1: 2grx C:158-235 [135571]
    Other proteins in same PDB: d2grxa1, d2grxb1
    automatically matched to d1u07a_
    complexed with dao, dpo, eap, fci, ftt, myr, po4

Details for d2grxc1

PDB Entry: 2grx (more details), 3.3 Å

PDB Description: crystal structure of tonb in complex with fhua, e. coli outer membrane receptor for ferrichrome
PDB Compounds: (C:) Protein tonB

SCOPe Domain Sequences for d2grxc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2grxc1 d.212.1.2 (C:158-235) TonB {Escherichia coli [TaxId: 562]}
rnqpqyparaqalriegqvkvkfdvtpdgrvdnvqilsakpanmferevknamrrwryep
gkpgsgivvnilfkingt

SCOPe Domain Coordinates for d2grxc1:

Click to download the PDB-style file with coordinates for d2grxc1.
(The format of our PDB-style files is described here.)

Timeline for d2grxc1: