Lineage for d2grxb1 (2grx B:19-725)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2251383Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2251501Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 2251661Family f.4.3.3: Ligand-gated protein channel [56948] (5 proteins)
    monomeric (22,24) barrel; ~150 N-terminal residues form a "plug" or "cork" subdomain
  6. 2251665Protein Ferric hydroxamate uptake receptor FhuA [56949] (1 species)
  7. 2251666Species Escherichia coli [TaxId:562] [56950] (10 PDB entries)
  8. 2251677Domain d2grxb1: 2grx B:19-725 [135570]
    Other proteins in same PDB: d2grxc1, d2grxd1
    automatically matched to d1fi1a_
    complexed with dao, dpo, eap, fci, ftt, myr, po4

Details for d2grxb1

PDB Entry: 2grx (more details), 3.3 Å

PDB Description: crystal structure of tonb in complex with fhua, e. coli outer membrane receptor for ferrichrome
PDB Compounds: (B:) Ferrichrome-iron receptor

SCOPe Domain Sequences for d2grxb1:

Sequence, based on SEQRES records: (download)

>d2grxb1 f.4.3.3 (B:19-725) Ferric hydroxamate uptake receptor FhuA {Escherichia coli [TaxId: 562]}
esawgpaatiaarqsatgtktdtpiqkvpqsisvvtaeemalhqpksvkealsytpgvsv
gtrgasntydhliirgfaaegqsqnnylnglklqgnfyndavidpymleraeimrgpvsv
lygksspggllnmvskrptteplkevqfkagtdslfqtgfdfsdsldddgvysyrltgla
rsanaqqkgseeqryaiapaftwrpddktnftflsyfqnepetgyygwlpkegtveplpn
gkrlptdfnegaknntysrnekmvgysfdhefndtftvrqnlrfaenktsqnsvygygvc
sdpanayskqcaalapadkghylarkyvvddeklqnfsvdtqlqskfatgdidhtlltgv
dfmrmrndinawfgyddsvpllnlynpsshhhhhhgssvntdfdfnakdpansgpyriln
kqkqtgvyvqdqaqwdkvlvtlggrydwadqeslnrvagttdkrddkqftwrggvnylfd
ngvtpyfsysesfepssqvgkdgnifapskgkqyevgvkyvpedrpivvtgavynltktn
nlmadpegsffsveggeirargveieakaalsasvnvvgsytytdaeyttdttykgntpa
qvpkhmaslwadytffdgplsgltlgtggrytgssygdpansfkvgsytvvdalvrydla
rvgmagsnvalhvnnlfdreyvascfntygcfwgaerqvvatatfrf

Sequence, based on observed residues (ATOM records): (download)

>d2grxb1 f.4.3.3 (B:19-725) Ferric hydroxamate uptake receptor FhuA {Escherichia coli [TaxId: 562]}
esawgpaatiaarqsatgtktdtpiqkvpqsisvvtaeemalhqpksvkealsytpgvsv
gtrgasntydhliirgfaaegqsqnnylnglklqgnfyndavidpymleraeimrgpvsv
lygksspggllnmvskrptteplkevqfkagtdslfqtgfdfsdsldddgvysyrltgla
rsanaqqkgseeqryaiapaftwrpddktnftflsyfqnepetgyygwlpkegtveplpn
gkrlptdfnegaknntysrnekmvgysfdhefndtftvrqnlrfaenktsqnsvygygvc
sdpanayskqcaalapadkghylarkyvvddeklqnfsvdtqlqskfatgdidhtlltgv
dfmrmrndinawfgyddsvpllnltdfdfnakdpansgpyrilnkqkqtgvyvqdqaqwd
kvlvtlggrydwadqeslnrvagttdkrddkqftwrggvnylfdngvtpyfsysesfeps
sqvgkdgnifapskgkqyevgvkyvpedrpivvtgavynltktnnlmadpegsffsvegg
eirargveieakaalsasvnvvgsytytdaeyttdttykgntpaqvpkhmaslwadytff
dgplsgltlgtggrytgssygdpansfkvgsytvvdalvrydlarvgmagsnvalhvnnl
fdreyvascfntygcfwgaerqvvatatfrf

SCOPe Domain Coordinates for d2grxb1:

Click to download the PDB-style file with coordinates for d2grxb1.
(The format of our PDB-style files is described here.)

Timeline for d2grxb1: