![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.8: TPR-like [48452] (11 families) ![]() |
![]() | Family a.118.8.4: PrgX C-terminal domain-like [140848] (2 proteins) |
![]() | Protein automated matches [254479] (1 species) not a true protein |
![]() | Species Enterococcus faecalis [TaxId:1351] [255040] (5 PDB entries) |
![]() | Domain d2grlc2: 2grl C:67-287 [135565] Other proteins in same PDB: d2grla1, d2grlb1, d2grlc1, d2grld1 automated match to d2awia2 |
PDB Entry: 2grl (more details), 3 Å
SCOPe Domain Sequences for d2grlc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2grlc2 a.118.8.4 (C:67-287) automated matches {Enterococcus faecalis [TaxId: 1351]} mntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynie vptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgkdy dltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqfl tdknidsylnavniinifkiigkedihrslveeltkisake
Timeline for d2grlc2: