Lineage for d2grlc2 (2grl C:67-287)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333768Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2333944Family a.118.8.4: PrgX C-terminal domain-like [140848] (2 proteins)
  6. 2333973Protein automated matches [254479] (1 species)
    not a true protein
  7. 2333974Species Enterococcus faecalis [TaxId:1351] [255040] (5 PDB entries)
  8. 2333978Domain d2grlc2: 2grl C:67-287 [135565]
    Other proteins in same PDB: d2grla1, d2grlb1, d2grlc1, d2grld1
    automated match to d2awia2

Details for d2grlc2

PDB Entry: 2grl (more details), 3 Å

PDB Description: Crystal structure of dCT/iCF10 complex
PDB Compounds: (C:) PrgX

SCOPe Domain Sequences for d2grlc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2grlc2 a.118.8.4 (C:67-287) automated matches {Enterococcus faecalis [TaxId: 1351]}
mntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynie
vptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgkdy
dltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqfl
tdknidsylnavniinifkiigkedihrslveeltkisake

SCOPe Domain Coordinates for d2grlc2:

Click to download the PDB-style file with coordinates for d2grlc2.
(The format of our PDB-style files is described here.)

Timeline for d2grlc2: